PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00155.45
Common NameAMTR_s00155p00069240, LOC18435920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 845aa    MW: 92325.3 Da    PI: 6.3706
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00155.45genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.8e-181775357
                                             --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                                 Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                             k  ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  evm_27.model.AmTr_v1.0_scaffold00155.45 17 KYVRYTPEQVEALERVYSECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 75
                                             6789*****************************************************97 PP

2START167.31e-521663732204
                                              HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGC CS
                                    START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeq 71 
                                              +aee+++e+++ka+ ++  Wv++  +++g++++ +++ s+++sg a+r++g+v  ++a  v+e+l+d++ 
  evm_27.model.AmTr_v1.0_scaffold00155.45 166 IAEETLAEFLSKATGTAVDWVQMLGMKPGPDSIGIVAVSHNCSGMAARVCGLVSLEPA-KVAEILKDRPS 234
                                              7899******************************************************.8888888888* PP

                                              T-TT-SEEEEEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--. CS
                                    START  72 Wdetlakaetlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe 138
                                              W +++++ ++l v   g  g+++l++++++a+++l++ Rdf+++Ry+  l +g++v++++S++s +  p+
  evm_27.model.AmTr_v1.0_scaffold00155.45 235 WFRDCRSHDVLTVFPAGngGTIELIYMQTYAPTTLAAaRDFWTLRYTTGLDDGSLVVCERSLTSSTGGPS 304
                                              **************99999************************************************999 PP

                                              ...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                                    START 139 ...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                                                 s s+vRae+ pSg+li+p+++g+s +++v+hvdl+++ ++++lr+l++s+ + ++k+++a+l++ +
  evm_27.model.AmTr_v1.0_scaffold00155.45 305 gptSLSFVRAEMMPSGYLIRPCEGGGSIIHIVDHVDLEAWNVPEVLRPLYESSKILAQKMTLAALRHIR 373
                                              9999*************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.581276IPR001356Homeobox domain
SMARTSM003894.2E-151480IPR001356Homeobox domain
PfamPF000464.8E-161775IPR001356Homeobox domain
CDDcd000862.97E-161777No hitNo description
SuperFamilySSF466891.54E-161779IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-181975IPR009057Homeodomain-like
CDDcd146861.78E-669108No hitNo description
PROSITE profilePS5084825.363156384IPR002913START domain
CDDcd088752.86E-70160376No hitNo description
SMARTSM002341.3E-47165375IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-20165370IPR023393START-like domain
SuperFamilySSF559614.81E-37165376No hitNo description
PfamPF018521.9E-50166373IPR002913START domain
PfamPF086704.9E-51701843IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MALVLQKDSN KHMDTSKYVR YTPEQVEALE RVYSECPKPS SLRRQQLIRE CPILSNIEPK  60
QIKVWFQNRR CREKQRKEAS RLQTVNRKLT AMNKLLMEEN DRLQKQVSQL VYENGYMKQQ  120
LQTASVATTD TSCESVVTSG QHQQLNPTPP PHPPRDANNP AGLLSIAEET LAEFLSKATG  180
TAVDWVQMLG MKPGPDSIGI VAVSHNCSGM AARVCGLVSL EPAKVAEILK DRPSWFRDCR  240
SHDVLTVFPA GNGGTIELIY MQTYAPTTLA AARDFWTLRY TTGLDDGSLV VCERSLTSST  300
GGPSGPTSLS FVRAEMMPSG YLIRPCEGGG SIIHIVDHVD LEAWNVPEVL RPLYESSKIL  360
AQKMTLAALR HIRQIAHEAS GEVNYGGGRQ PAVLRTFSQR LSRGFNDAVN GFADDGWSLM  420
SSDGVEDVTI VLNTNPSKLF AANVNSAAAI STFGGGILCA KASMLLQNVP PALLVRFLRE  480
HRSEWADSGV DAYAASSMRT GQFVVPGSRT GSFPGSQVIL PLAQTVEHEE FLEVIRLEGH  540
GFSQDDAVLP RDMFLLQLCS GVDENAVGAC AQLVFAPIDE SFADDAPLLP SGFRVIPLDS  600
KSDGPGTNRT LDLASSIDVG STGSRPSGES GANGYTMRSV LTIAFQFTYE THLRDNVVAM  660
ARQYVRSVMA SVQRVAMAIS PSRMGPGLGP RPPPGTPEAV TLARWICQSY RFHSGVELLR  720
VDSQAGDSLL KLLWHHSDAI MCCSLKASPI FSFSNQAGLD MLETTLVALQ DITLDKILDE  780
NGRKVLYSEF PKIMQQGFAY LPAGICVSSM GRPVSYEQAV AWKVLNEDDC THCLAFMFLN  840
WSFV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846015.10.0PREDICTED: homeobox-leucine zipper protein HOX32 isoform X1
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLW1PKQ60.0W1PKQ6_AMBTC; Uncharacterized protein
STRINGVIT_10s0003g04670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6511671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]